PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.18G096600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NAC
Protein Properties Length: 593aa    MW: 66064.5 Da    PI: 4.5944
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.18G096600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.93.4e-52201462128
                  NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                          ppGfrFhPtdeelv +yLk+k+ +++l+l ++i+ vd+yk++P++Lp +  +k+++++w+fFs+rd+ky++g r+nrat +gyWkatgkd
  Manes.18G096600.1.p  20 PPGFRFHPTDEELVLYYLKRKICKRRLRL-DIISVVDVYKWDPEELPgQsLLKTGDRQWFFFSPRDRKYPNGARSNRATIQGYWKATGKD 108
                          8***************************9.99**************96347788999********************************* PP

                  NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++++  ++++vg+kktLvfy+grap+ge+tdWvmhey+l
  Manes.18G096600.1.p 109 RNITY-NSRNVGVKKTLVFYRGRAPNGERTDWVMHEYTL 146
                          *****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-5918169IPR003441NAC domain
PROSITE profilePS5100555.01219169IPR003441NAC domain
PfamPF023651.8E-2720146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MTVTADSSLA PDGGEDKVWP PGFRFHPTDE ELVLYYLKRK ICKRRLRLDI ISVVDVYKWD  60
PEELPGQSLL KTGDRQWFFF SPRDRKYPNG ARSNRATIQG YWKATGKDRN ITYNSRNVGV  120
KKTLVFYRGR APNGERTDWV MHEYTLDEEE LKSCLNVQDY YALYKVYKKS GPGPKNGEQY  180
GAPFKEEDWA DDKYEDVNNC DTPVKQPVTV MPPVDTVKAI AQLDQPLNAL ENFINQIAEE  240
IPIHHPQIND YDYTNGLLQF AGEDETQSTL LDPSPREVIL PEPISLSSTS VQQASLDFNQ  300
SATPAFQSLE IPQGKSGPHN TDEGPKLHEG DFLEVDDLSE INDLVNINDL VSQEPTLLHT  360
EKSGETLGLD HFVGLSDFDV YQDAAMFLRE MVPVGQDTVL HANTVGFQLQ SRSLMNQVDY  420
QLQPHSAVNN VDSLQPQAFG ADQLWVDDQR SNIHTPTEPI HGTLSQPTPG VAYESTNNTG  480
GDNGNQSGDA TGWFSSSLWN FVDSIPTSPA SACETPLVNK AFDQMSSFSR MKLNVKNNNT  540
NTENLVGRNR AANSTRAGES SRGFLLLAIF GALCAILWIL ARTSLLKGAI FS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-492014616140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13845RKICKRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR6051400.0KR605140.1 Manihot esculenta NAC transcription factors 2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012073984.10.0PREDICTED: uncharacterized protein LOC105635527
TrEMBLA0A0M4FBP00.0A0A0M4FBP0_MANES; NAC transcription factors 2
STRINGPOPTR_0002s06210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-135NAC domain containing protein 17
Publications ? help Back to Top
  1. Hu W, et al.
    Genome-Wide Identification and Expression Analysis of the NAC Transcription Factor Family in Cassava.
    PLoS ONE, 2015. 10(8): p. e0136993
    [PMID:26317631]